DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sob and drm

DIOPT Version :9

Sequence 1:NP_476882.1 Gene:sob / 33581 FlyBaseID:FBgn0004892 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster


Alignment Length:71 Identity:37/71 - (52%)
Similarity:50/71 - (70%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 RSKKQFICKFCNRQFTKSYNLLIHERTH-TDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKC 453
            |.|.:||||:|.|:|||.|||:|||||| :.|..|||::|||.|:::|:||.||.:|..      
  Fly    21 RPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLHMD------ 79

  Fly   454 AECGKG 459
             .||:|
  Fly    80 -TCGRG 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sobNP_476882.1 COG5048 <389..529 CDD:227381 37/71 (52%)
C2H2 Zn finger 397..417 CDD:275368 14/19 (74%)
zf-H2C2_2 409..434 CDD:290200 16/25 (64%)
C2H2 Zn finger 425..445 CDD:275368 10/19 (53%)
zf-H2C2_2 437..460 CDD:290200 8/23 (35%)
C2H2 Zn finger 453..473 CDD:275368 3/7 (43%)
zf-C2H2 479..501 CDD:278523
C2H2 Zn finger 481..501 CDD:275368
zf-H2C2_2 493..518 CDD:290200
C2H2 Zn finger 509..529 CDD:275368
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 14/19 (74%)
C2H2 Zn finger 57..77 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.