DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sob and Osr1

DIOPT Version :9

Sequence 1:NP_476882.1 Gene:sob / 33581 FlyBaseID:FBgn0004892 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_001100186.1 Gene:Osr1 / 298878 RGDID:1311807 Length:266 Species:Rattus norvegicus


Alignment Length:150 Identity:90/150 - (60%)
Similarity:102/150 - (68%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 DSALHSLQATMYQDKMSVISGAAGGVGAGAVGGLEEAGSSAAAAAAQR------SKKQFICKFCN 401
            |.|..:|.||. :|...:..|...|..||.:|.|.:....:......|      :||:|:||||.
  Rat   118 DFANLALAATQ-EDPTKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCG 181

  Fly   402 RQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCAECGKGFCQSRTL 466
            |.||||||||||||||||||||:||||.||||||||||||||||||||||||.||||||||||||
  Rat   182 RHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTL 246

  Fly   467 AVHKILH-----MEESPHKC 481
            ||||.||     ::.|..||
  Rat   247 AVHKTLHSQVKELKTSKIKC 266

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
sobNP_476882.1 COG5048 <389..529 CDD:227381 77/103 (75%)
C2H2 Zn finger 397..417 CDD:275368 17/19 (89%)
zf-H2C2_2 409..434 CDD:290200 22/24 (92%)
C2H2 Zn finger 425..445 CDD:275368 18/19 (95%)
zf-H2C2_2 437..460 CDD:290200 21/22 (95%)
C2H2 Zn finger 453..473 CDD:275368 17/19 (89%)
zf-C2H2 479..501 CDD:278523 1/2 (50%)