DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sob and Zfp651

DIOPT Version :9

Sequence 1:NP_476882.1 Gene:sob / 33581 FlyBaseID:FBgn0004892 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_001160116.1 Gene:Zfp651 / 270210 MGIID:2670992 Length:729 Species:Mus musculus


Alignment Length:558 Identity:118/558 - (21%)
Similarity:180/558 - (32%) Gaps:127/558 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AAAAAAAAAATCSDSPAKAAASPAASSDIAEALGELKASATAAASSASKAATSKHHSNNNHKPSA 73
            |.||....:||...:..........:.:.|||.|.|                .|..|....:|..
Mouse   198 AGAAGDVGSATAGPAQTLFKEEKEGAPEEAEAPGSL----------------CKLESGEGLEPEL 246

  Fly    74 AATATAAHKKSE----SCNSNGNKCTAATSPIGSKTSNAAMAAATATAAAATNDLAAAAAVVLSL 134
            .|:.|..|::..    ..|.|......:|.|.|...|.                 |..|.|||..
Mouse   247 DASGTYGHQEQSQIIVEVNLNNQTLHVSTGPEGKPGSG-----------------ANPATVVLGQ 294

  Fly   135 QGTMVSSLQQAALLPANSAAAAALNLQALESYLAL-----QRLTGKSDVFRFSNSNTGSSNSNNA 194
            :..|....::.......|........:..|...:.     :...|.||.....:...|.|..   
Mouse   295 EDGMQGHSEEEEEEGGGSGGGEEEEEEEEEEEGSQGEEEEEEEEGPSDHREDEDEEDGPSEQ--- 356

  Fly   195 TTCNSSSSEADNNALPSLIDIANIELKSSCSSSSSGEPPLTAATASA-------AATSSPSSNNS 252
               ::.|||.:..| ....|.|.   .:.|..|....||.:..:..:       .||..|.....
Mouse   357 ---DAESSEEEREA-EGRQDPAG---PAGCQGSQVDPPPHSRMSTRSRGQNTRRRATPEPEEAGR 414

  Fly   253 NSTSTPTTSKCVPLPSIGTVSAAVAAAAAAAAAAASQQAALDCA--------------------T 297
            .....|..|        |.|.|:.||....|.....::....|.                    :
Mouse   415 RGGKRPKAS--------GAVPASQAADGLGAKVKLEEKQQHPCQKCPRVFNNRWYLEKHMNVTHS 471

  Fly   298 AAELAAECDLP-LLDGEDALSFEAGDLDSSYGSFMFNPSAFSQAETDSALHSLQATMYQDKMSVI 361
            ..::..:|... ||:.|..|..:. |.:.       |....:..:....|.||     .:...::
Mouse   472 RMQICGQCGKRFLLESELQLHRQT-DCER-------NIQCMTCGKAFKKLWSL-----HEHNKIV 523

  Fly   362 SGAAGGVGAGAVGGLEEAGSSAAAAAAQRSKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCD 426
            .|.|                          :|:|.|:.|.::|....::..|...||.:.|::|:
Mouse   524 HGYA--------------------------EKKFSCEICEKKFHTMAHVRKHMVAHTKDMPFTCE 562

  Fly   427 ICGKAFRRQDHLRDHRYIHSKEKPFKCAECGKGFCQSRTLAVHKILHMEESPHKCPVCNRSFNQR 491
            .|||:|:|...|:.|...||.||||:|..|.:.|.....|..|..:|:......|..|.:.||.:
Mouse   563 TCGKSFKRSMSLKVHSLQHSGEKPFRCENCNERFQYKYQLRSHMSIHIGHKQFMCQWCGKDFNMK 627

  Fly   492 SNLKTHLLTHTDIKPYNCASCGKVFRRNCDLRRHSLTH 529
            .....|:.|||..|||.|..|||.|....:::||..||
Mouse   628 QYFDEHMKTHTGEKPYICEICGKSFTSRPNMKRHRRTH 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sobNP_476882.1 COG5048 <389..529 CDD:227381 47/139 (34%)
C2H2 Zn finger 397..417 CDD:275368 4/19 (21%)
zf-H2C2_2 409..434 CDD:290200 9/24 (38%)
C2H2 Zn finger 425..445 CDD:275368 8/19 (42%)
zf-H2C2_2 437..460 CDD:290200 10/22 (45%)
C2H2 Zn finger 453..473 CDD:275368 5/19 (26%)
zf-C2H2 479..501 CDD:278523 5/21 (24%)
C2H2 Zn finger 481..501 CDD:275368 5/19 (26%)
zf-H2C2_2 493..518 CDD:290200 12/24 (50%)
C2H2 Zn finger 509..529 CDD:275368 7/19 (37%)
Zfp651NP_001160116.1 BTB 32..138 CDD:279045
BTB 46..141 CDD:197585
C2H2 Zn finger 449..468 CDD:275368 1/18 (6%)
C2H2 Zn finger 476..495 CDD:275368 5/18 (28%)
C2H2 Zn finger 503..523 CDD:275368 3/24 (13%)
COG5048 531..>612 CDD:227381 28/80 (35%)
C2H2 Zn finger 533..553 CDD:275368 4/19 (21%)
zf-H2C2_2 545..570 CDD:290200 9/24 (38%)
C2H2 Zn finger 561..581 CDD:275368 8/19 (42%)
zf-H2C2_2 573..596 CDD:290200 10/22 (45%)
cxxc_20_cxxc 588..>632 CDD:274982 10/43 (23%)
C2H2 Zn finger 589..609 CDD:275368 5/19 (26%)
C2H2 Zn finger 617..637 CDD:275368 5/19 (26%)
zf-H2C2_2 629..654 CDD:290200 12/24 (50%)
COG5048 641..>690 CDD:227381 12/25 (48%)
C2H2 Zn finger 645..665 CDD:275368 7/19 (37%)
zf-H2C2_2 657..680 CDD:290200 4/9 (44%)
C2H2 Zn finger 673..689 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4627
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.