DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sob and GFI1

DIOPT Version :9

Sequence 1:NP_476882.1 Gene:sob / 33581 FlyBaseID:FBgn0004892 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_001120687.1 Gene:GFI1 / 2672 HGNCID:4237 Length:422 Species:Homo sapiens


Alignment Length:419 Identity:117/419 - (27%)
Similarity:163/419 - (38%) Gaps:64/419 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LPANSAAAAALNLQALESYLALQRLTGKSDVFRFSNSNTGSSNSNNATTCNSSSSEADNNALPSL 212
            :||.|.|.:..|....::. ...||:.:|.:....:..:.|.:|...:.| ..|||.::...|..
Human    32 VPAPSRADSTSNAGGAKAE-PRDRLSPESQLTEAPDRASASPDSCEGSVC-ERSSEFEDFWRPPS 94

  Fly   213 IDIANIELKSSCSSSSSGEP-PLTAATASAAATSSPSSNNSNSTSTPTTSK---------CVPLP 267
            ...:....||.|.|....:| ||.....|.:..:.....:...:..|..:.         |.|.|
Human    95 PSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAP 159

  Fly   268 SIGTVSAAVAAAAAAAAAAASQQAALDCATAAELAAECDLPLLDGEDALSFEAGDLDSSYGSFMF 332
            ..|..:|......||..|.|.  |...|:..|...|...|.|.          ||..|:......
Human   160 EPGHPAALYGPKRAAGGAGAG--APGSCSAGAGATAGPGLGLY----------GDFGSAAAGLYE 212

  Fly   333 NPSAFSQAETDSALHSLQATMYQDKMSVISGAAGGVGAGA------------VGG---------- 375
            .|:|.:........|.|.|    ||           |||.            :||          
Human   213 RPTAAAGLLYPERGHGLHA----DK-----------GAGVKVESELLCTRLLLGGGSYKCIKCSK 262

  Fly   376 --LEEAGSSAAAAAAQRSKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHL 438
              ....|.......:....:.|.|:.|.:.|..:.:|..|:..|:.||.:.|.||||:|:|...|
Human   263 VFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTL 327

  Fly   439 RDHRYIHSKEKPFKCAECGKGFCQSRTLAVHKILHMEESPHKCPVCNRSFNQRSNLKTHLLTHTD 503
            ..|..|||..:|:.|..|||.|.|...:..|..:|..|.||||.||.::|:|.|||.||...||.
Human   328 STHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTG 392

  Fly   504 IKPYNCASCGKVFRRNCDLRRHSLT-HNL 531
            .||:.|..|||.|:|..|||||..| |.|
Human   393 FKPFGCDLCGKGFQRKVDLRRHRETQHGL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sobNP_476882.1 COG5048 <389..529 CDD:227381 60/140 (43%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
zf-H2C2_2 409..434 CDD:290200 11/24 (46%)
C2H2 Zn finger 425..445 CDD:275368 9/19 (47%)
zf-H2C2_2 437..460 CDD:290200 10/22 (45%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
zf-C2H2 479..501 CDD:278523 12/21 (57%)
C2H2 Zn finger 481..501 CDD:275368 10/19 (53%)
zf-H2C2_2 493..518 CDD:290200 13/24 (54%)
C2H2 Zn finger 509..529 CDD:275368 12/20 (60%)
GFI1NP_001120687.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..109 18/78 (23%)
SNAG domain. /evidence=ECO:0000250 1..20
Required for interaction with RELA. /evidence=ECO:0000269|PubMed:20547752 140..257 31/143 (22%)
COG5048 <254..416 CDD:227381 60/161 (37%)
C2H2 Zn finger 257..278 CDD:275368 1/20 (5%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 9/19 (47%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
C2H2 Zn finger 370..390 CDD:275368 10/19 (53%)
C2H2 Zn finger 398..417 CDD:275368 11/18 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4496
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.