DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sob and Gfi1

DIOPT Version :9

Sequence 1:NP_476882.1 Gene:sob / 33581 FlyBaseID:FBgn0004892 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_036698.1 Gene:Gfi1 / 24388 RGDID:2680 Length:423 Species:Rattus norvegicus


Alignment Length:394 Identity:111/394 - (28%)
Similarity:161/394 - (40%) Gaps:57/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 QRLTGKSDVFRFSNSNTGSSNSNNATTCNSSSSEADNNALPSLIDIANIELKSSCSSSSSGEP-- 232
            :||:.:|.:....:..:.|.||...:.|: .|||.::...|....::....||.|.|....:|  
  Rat    54 ERLSPESQLTEAPDRASASPNSCEGSVCD-PSSEFEDYWRPPSPSVSPASEKSLCRSLDEAQPYT 117

  Fly   233 -PLTAATASAAATS-------SPSSNNSNSTSTPTTSKCVPLPSIGTVSAAVAAAAAAAAAAASQ 289
             |......|..|.|       |....::...|...:..|......|..:|...:..||..|.|.|
  Rat   118 LPFKPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGAESGRPAARYGSEQAAGGAGAGQ 182

  Fly   290 QAALDCATAAELAAECDLPLLDGEDALSFEAGDLDSSYGSFMFNPSAFSQAETDSALHSLQATMY 354
            ..:...|:.|..|....|                   ||.|.  |:|....|..|   :....:|
  Rat   183 PGSCGAASGATSAGGLGL-------------------YGDFA--PAAAGLFERPS---TAAGRLY 223

  Fly   355 QDK-MSVISGAAGGV-------------GAGAVGGLE-------EAGSSAAAAAAQRSKKQFICK 398
            ||: ..:.:..:.||             |.|:...::       ..|.......:....:.|.|:
  Rat   224 QDRGHELHADKSVGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACE 288

  Fly   399 FCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCAECGKGFCQS 463
            .|.:.|..:.:|..|:..|:.||.:.|.||||:|:|...|..|..|||..:|:.|..|||.|.|.
  Rat   289 MCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQK 353

  Fly   464 RTLAVHKILHMEESPHKCPVCNRSFNQRSNLKTHLLTHTDIKPYNCASCGKVFRRNCDLRRHSLT 528
            ..:..|..:|..|.||||.||.::|:|.|||.||...||..||:.|..|||.|:|..|||||..|
  Rat   354 SDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRET 418

  Fly   529 -HNL 531
             |.|
  Rat   419 QHGL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sobNP_476882.1 COG5048 <389..529 CDD:227381 60/140 (43%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
zf-H2C2_2 409..434 CDD:290200 11/24 (46%)
C2H2 Zn finger 425..445 CDD:275368 9/19 (47%)
zf-H2C2_2 437..460 CDD:290200 10/22 (45%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
zf-C2H2 479..501 CDD:278523 12/21 (57%)
C2H2 Zn finger 481..501 CDD:275368 10/19 (53%)
zf-H2C2_2 493..518 CDD:290200 13/24 (54%)
C2H2 Zn finger 509..529 CDD:275368 12/20 (60%)
Gfi1NP_036698.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102 11/48 (23%)
SNAG domain. /evidence=ECO:0000250 1..20
Required for interaction with RELA. /evidence=ECO:0000250 141..258 27/140 (19%)
COG5048 <255..417 CDD:227381 60/161 (37%)
C2H2 Zn finger 258..279 CDD:275368 1/20 (5%)
C2H2 Zn finger 287..307 CDD:275368 5/19 (26%)
zf-H2C2_2 299..324 CDD:290200 11/24 (46%)
C2H2 Zn finger 315..335 CDD:275368 9/19 (47%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
zf-H2C2_2 355..380 CDD:290200 10/24 (42%)
C2H2 Zn finger 371..391 CDD:275368 10/19 (53%)
C2H2 Zn finger 399..418 CDD:275368 11/18 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4427
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.