DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sob and Zbtb7c

DIOPT Version :9

Sequence 1:NP_476882.1 Gene:sob / 33581 FlyBaseID:FBgn0004892 Length:578 Species:Drosophila melanogaster
Sequence 2:XP_036016934.1 Gene:Zbtb7c / 207259 MGIID:2443302 Length:625 Species:Mus musculus


Alignment Length:129 Identity:43/129 - (33%)
Similarity:57/129 - (44%) Gaps:28/129 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 CKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCAECGKGFC 461
            |..|::....:..|..|.||||.|:||.|.||...|.|||.|:.|...|:.|:|:.|        
Mouse   372 CPICHKVIMGAGKLPRHMRTHTGEKPYMCSICEVRFTRQDKLKIHMRKHTGERPYLC-------- 428

  Fly   462 QSRTLAVHKILHMEESPHKCPVCNRSFNQRSNLKTHLLTHTDIKPYNCASCGKVFRRNCDLRRH 525
                  :|              ||..|....:||.|:..||.::||.|..|.|.|.|:..|.||
Mouse   429 ------IH--------------CNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRH 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sobNP_476882.1 COG5048 <389..529 CDD:227381 43/129 (33%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
zf-H2C2_2 409..434 CDD:290200 13/24 (54%)
C2H2 Zn finger 425..445 CDD:275368 9/19 (47%)
zf-H2C2_2 437..460 CDD:290200 6/22 (27%)
C2H2 Zn finger 453..473 CDD:275368 2/19 (11%)
zf-C2H2 479..501 CDD:278523 6/21 (29%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
zf-H2C2_2 493..518 CDD:290200 11/24 (46%)
C2H2 Zn finger 509..529 CDD:275368 8/17 (47%)
Zbtb7cXP_036016934.1 BTB_POZ_ZBTB7C_ZBTB36 15..134 CDD:349637
C2H2 Zn finger 372..392 CDD:275368 5/19 (26%)
SFP1 <386..474 CDD:227516 40/115 (35%)
C2H2 Zn finger 400..420 CDD:275368 9/19 (47%)
C2H2 Zn finger 428..448 CDD:275368 8/47 (17%)
C2H2 Zn finger 456..474 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4627
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.