DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sob and odd-1

DIOPT Version :9

Sequence 1:NP_476882.1 Gene:sob / 33581 FlyBaseID:FBgn0004892 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_498552.2 Gene:odd-1 / 181893 WormBaseID:WBGene00003845 Length:242 Species:Caenorhabditis elegans


Alignment Length:160 Identity:75/160 - (46%)
Similarity:102/160 - (63%) Gaps:5/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 DLDSSYGSFMFNPSAFSQAETDSALHSLQATMYQDK---MSVISGAAGGVGAGAVGGLEEAGSSA 383
            ||.:...|...:||: |...::::..::.|.|..:.   :.:.|.....:|.......|: .:..
 Worm    54 DLQNWLTSLCISPSS-SPTPSNASTSTIPAQMTNENVLHLQIQSQLFSNLGTPWFLNPEQ-HNKT 116

  Fly   384 AAAAAQRSKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKE 448
            ..|..:|.||:||||:|.|.|||||||:|||||||:|||:.|:.|||:||||||||||:|||:||
 Worm   117 NNAIRKRPKKEFICKYCARHFTKSYNLMIHERTHTNERPFHCETCGKSFRRQDHLRDHKYIHAKE 181

  Fly   449 KPFKCAECGKGFCQSRTLAVHKILHMEESP 478
            ||.||..|||||||.|||.||:..|..:.|
 Worm   182 KPHKCEICGKGFCQLRTLNVHRSCHHVQEP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sobNP_476882.1 COG5048 <389..529 CDD:227381 63/90 (70%)
C2H2 Zn finger 397..417 CDD:275368 15/19 (79%)
zf-H2C2_2 409..434 CDD:290200 17/24 (71%)
C2H2 Zn finger 425..445 CDD:275368 15/19 (79%)
zf-H2C2_2 437..460 CDD:290200 17/22 (77%)
C2H2 Zn finger 453..473 CDD:275368 13/19 (68%)
zf-C2H2 479..501 CDD:278523 75/160 (47%)
C2H2 Zn finger 481..501 CDD:275368
zf-H2C2_2 493..518 CDD:290200
C2H2 Zn finger 509..529 CDD:275368
odd-1NP_498552.2 C2H2 Zn finger 130..150 CDD:275368 15/19 (79%)
zf-H2C2_2 142..167 CDD:290200 17/24 (71%)
C2H2 Zn finger 158..178 CDD:275368 15/19 (79%)
zf-H2C2_2 170..193 CDD:290200 17/22 (77%)
C2H2 Zn finger 186..206 CDD:275368 13/19 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7667
eggNOG 1 0.900 - - E33208_3B9IA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 1 1.000 - - mtm4817
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14196
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.