DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTR2C and YJL068C

DIOPT Version :10

Sequence 1:NP_000859.2 Gene:HTR2C / 3358 HGNCID:5295 Length:458 Species:Homo sapiens
Sequence 2:NP_012467.1 Gene:YJL068C / 853377 SGDID:S000003604 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:23/104 - (22%)
Similarity:37/104 - (35%) Gaps:20/104 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   166 NSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDP----NFVLIGSFVAFFIP 226
            |:..||..:..   |...|.::..|....|.:|         |.|||    :|   |....|::.
Yeast    64 NASEKAFWQFQ---ADKYGFAIVFPDTSPRGDE---------VANDPEGSWDF---GQGAGFYLN 113

Human   227 LTIMVITYCLTIY-VLRRQALMLLHGHTEEPPGLSLDFL 264
            .|.........:| .:.::....|..|..:...:.||||
Yeast   114 ATQEPYAQHYQMYDYIHKELPQTLDSHFNKNGDVKLDFL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HTR2CNP_000859.2 7tmA_5-HT2C 54..385 CDD:341346 23/104 (22%)
TM helix 1 55..81 CDD:341346
TM helix 2 88..114 CDD:341346
TM helix 3 127..157 CDD:341346
DRY motif, important for ligand-induced conformation changes. /evidence=ECO:0000250|UniProtKB:P41595 151..153
TM helix 4 169..192 CDD:341346 5/22 (23%)
TM helix 5 211..240 CDD:341346 7/33 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..301
TM helix 6 304..334 CDD:341346
TM helix 7 347..372 CDD:341346
NPxxY motif, important for ligand-induced conformation changes and signaling. /evidence=ECO:0000250|UniProtKB:P41595 364..368
PDZ-binding 456..458
YJL068CNP_012467.1 alpha/beta hydrolases 2..296 CDD:473884 23/104 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.