DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spindly and SPDL1

DIOPT Version :9

Sequence 1:NP_608791.2 Gene:Spindly / 33578 FlyBaseID:FBgn0031549 Length:781 Species:Drosophila melanogaster
Sequence 2:NP_001316568.1 Gene:SPDL1 / 54908 HGNCID:26010 Length:622 Species:Homo sapiens


Alignment Length:602 Identity:137/602 - (22%)
Similarity:249/602 - (41%) Gaps:163/602 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DQSEKDAQRIYELKRNLDTALAAESYLTQE-----LEHLSSQPVAIASGGNGQELEELRRKFKTL 90
            :|.:...||..|||..:..:|:.|....::     ||.|..|    .|..:|||:.||:.|.:.|
Human    56 EQEKYTLQREVELKSRMLESLSCECEAIKQQQKMHLEKLEEQ----LSRSHGQEVNELKTKIEKL 116

  Fly    91 KEEQDVLQQDYDAKVEETRSLKDKLTAAEKNLAEKSAS---RSNQLHDDFFARLNALELENCELL 152
            |.|.|      :|::.| :.||.::...::.|:.||..   .|.::.:...:.:.||::|     
Human   117 KVELD------EARLSE-KQLKHQVDHQKELLSCKSEELRVMSERVQESMSSEMLALQIE----- 169

  Fly   153 QKLAEYEDLRIANTLAVAEKEKTIECLQDRVSCMEQNLNCKRDELEEK----------------- 200
              |.|.|.::    ..:.|:...::..|:::..:..||..:.|.|:|:                 
Human   170 --LTEMESMK----TTLKEEVNELQYRQEQLELLITNLMRQVDRLKEEKEEREKEAVSYYNALEK 228

  Fly   201 -------LQL-LESCQEQLVDANAKIALLTSAPENNDRKGNSLFAEVDDQRQAMKQILAAQKKSY 257
                   ||: |:...:|.:|.|:              |||||||||:|:|.||::.|.:.|..|
Human   229 ARVANQDLQVQLDQALQQALDPNS--------------KGNSLFAEVEDRRAAMERQLISMKVKY 279

  Fly   258 LDMKKIFTDSQFEIRRLKRENVAMHTELQACSTIFCSADK--TYQNKLNERIRQLMTANDSLERQ 320
            ..:||....::.:::|:|.: :|...:::...|.|...::  ....:.|..|:.|:....:||:.
Human   280 QSLKKQNVFNREQMQRMKLQ-IATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKF 343

  Fly   321 LNL--SQERLRQLAS---EKSVTWLDSM---LDFCKRETDELKAQLHSMRIQKAGLEERMRCVQQ 377
            .||  |.|....:.|   |.:..:.|.:   ||...:|.:..|.:|...|::  .|.|..|.:..
Human   344 KNLYDSMESKPSVDSGTLEDNTYYTDLLQMKLDNLNKEIESTKGELSIQRMK--ALFESQRALDI 406

  Fly   378 EMARWRFESLKSRCV-LIDRENL-----LAEHKIVFKPMQAMEFNIKEAELKTALPRIVSVAAQS 436
            |...:..|    ||: |.:.||:     |.|.|:.::|.:.:|..:                   
Human   407 ERKLFANE----RCLQLSESENMKLRAKLDELKLKYEPEETVEVPV------------------- 448

  Fly   437 PSSSAQLHTHPETSLKSAAETTSKSFPTATEIIVLDAPL------KPAIKEEVVEPLSQELKPAL 495
                          ||...|.......||.:..|.::.|      .|..|||     :|....:|
Human   449 --------------LKKRREVLPVDITTAKDACVNNSALGGEVYRLPPQKEE-----TQSCPNSL 494

  Fly   496 KDTSVKVEQELEVSESKACIKRTPIKTIMGMKIKREIDLNLEQQDAVDIKKELEAPELIPKPQLK 560
            :|.::::|:.:.:        .||:.::...|     :|.::.|    :|||.:..:||      
Human   495 EDNNLQLEKSVSI--------YTPVVSLSPHK-----NLPVDMQ----LKKEKKCVKLI------ 536

  Fly   561 GTPVKA----KNDGVTP 573
            |.|..|    :..|.||
Human   537 GVPADAEALSERSGNTP 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpindlyNP_608791.2 Smc <11..336 CDD:224117 84/344 (24%)
SPDL1NP_001316568.1 GrpE 351..>417 CDD:295646 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9050
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5266
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.