DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spindly and Spdl1

DIOPT Version :9

Sequence 1:NP_608791.2 Gene:Spindly / 33578 FlyBaseID:FBgn0031549 Length:781 Species:Drosophila melanogaster
Sequence 2:NP_001029310.1 Gene:Spdl1 / 303037 RGDID:1306908 Length:597 Species:Rattus norvegicus


Alignment Length:593 Identity:144/593 - (24%)
Similarity:240/593 - (40%) Gaps:118/593 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HQQLKDQSEKDAQRIYELKRNLDTALAAESYLTQELEHLSSQPVAIAS-------GGNGQELEEL 83
            |:::...:|...|..|.|:|.::........|:.|.|.|..|..|...       ..:.||:..|
  Rat    44 HEEMMTTAENYNQEKYALQREVELKSRMLESLSCECEALRQQQKAQLEQLEMQLHRSHRQEVHGL 108

  Fly    84 RRKFKTLKEEQDVLQQDYDAKVEETRSLKDKLTAAEKNLAEKSASRSNQLHDDFFARLNALELEN 148
            |.|.:.||.|.|      :|::.| :.||.||....:.|:.|    |.:|.  ..:...||...:
  Rat   109 RNKLENLKVELD------EARLSE-KQLKQKLDHQGELLSHK----SEELR--LLSEQRALSSVS 160

  Fly   149 CELLQ---KLAEYEDLRIANTLAVAEKEKTIECLQDRVSCMEQNLNCKRDELEEKLQ-------- 202
            .|||.   :|.|.|.::    .|:.|:...::|.|:::.|:..:|..:.|.|:|:.:        
  Rat   161 SELLSLQTELTEAEGVK----NALREEVNELQCKQEQLECLNASLLHQVDRLKEEKEEREKEAVS 221

  Fly   203 ---LLESCQEQLVDANAKI--ALLTSAPENNDRKGNSLFAEVDDQRQAMKQILAAQKKSYLDMKK 262
               .||..:.:..|...::  ||..:|..|:  |||||||||:|:|.||::.|...|..|..:||
  Rat   222 YYNALEKARVENQDLQVQLGHALQQAADPNS--KGNSLFAEVEDRRVAMERRLNLMKDKYQSLKK 284

  Fly   263 --IFTDSQFEIRRLKRENV----AMHTELQACSTIFCSADKTYQNKLNERIRQLMTANDSLERQL 321
              .||..|....:|:...:    ...||.:....:|...::.     |..|:.|:...:.||:..
  Rat   285 QNAFTRDQMNKMKLQISTLLRMRGSQTEFEQQERLFAMLEQK-----NGEIKHLLGEINKLEKFK 344

  Fly   322 NLSQERLRQLAS--------EKSVTWLDSM---LDFCKRETDELKAQLHSMRIQKAGLEERMRCV 375
            || .|.:...:|        |.|..:.|.:   ||...:|.:..|.:|...|::  .|.|..|.:
  Rat   345 NL-YENMESKSSTSDSACALEDSTYYTDLLQLKLDKLNKENESTKGELSIQRMK--ALFESQRTL 406

  Fly   376 QQEMARWRFESLKSRCVLIDRENL-----LAEHKIVFKPMQAMEFNIKEAELKTALPRIVSVAAQ 435
            ..|...:..|   ....|.:.|||     |.|.|:.::|.:.:|..:.:.. :..||..::...:
  Rat   407 DIERKLFANE---RHLQLSESENLKLRAKLDELKLKYEPEERIEVPVLKRR-REVLPLNINTPEE 467

  Fly   436 SPSSSA--------QLHTHPETSLKSAAETT-----------SKSFPTATEIIVLDAPLKPAIKE 481
            :.::||        .|....|:.|.:..:.|           .||.|..|:      |.|.....
  Rat   468 TAAASATGEDVSRLPLERKEESCLDNLKDNTVQWKQPASLSPHKSLPLDTQ------PKKEKCVT 526

  Fly   482 EVVEPLSQEL----------KPALKD-----TSVKVEQELEVSESKACIKRTPIKTIMGMKIKRE 531
            .|..|.|.|:          .|.|.:     |.||..:|......|...|::  .|||.:..|..
  Rat   527 LVASPASTEVLHEQSGNTPSSPRLTEESRLPTKVKERKEATSKLEKGASKKS--HTIMYVSSKST 589

  Fly   532 IDLNLEQQ 539
            .::...||
  Rat   590 PEMQCPQQ 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpindlyNP_608791.2 Smc <11..336 CDD:224117 90/346 (26%)
Spdl1NP_001029310.1 DUF342 <265..351 CDD:302792 23/91 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..597 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.