DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and mamdc2b

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_017213507.1 Gene:mamdc2b / 798369 ZFINID:ZDB-GENE-091117-16 Length:698 Species:Danio rerio


Alignment Length:244 Identity:70/244 - (28%)
Similarity:109/244 - (44%) Gaps:54/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EQIQNGFV-----LNAPMKAKII----CSD--GHGLVGNRIAYCDGEKWSTQLGSCALRRQT--- 127
            |:|:|.::     :.:..||:::    |.|  ..|.||     .|..|.:.  |.|:|...:   
Zfish   454 EKIRNVWIAVELTIQSEKKAQVVFISTCKDIWSCGSVG-----LDDIKVTP--GDCSLLAASSLL 511

  Fly   128 IDVSCDFESEDMCGWTAE-LSFLGTW--KRVSTVADFHSEKTGPQKDHTFQNQSIGHYVRMETES 189
            :...||||| .:||::.: :...|.|  .|..|...:    |||..|||   ..:|||:.:|...
Zfish   512 LPSHCDFES-GLCGFSQDKVGDSGDWYLARGPTPTSY----TGPGGDHT---TGLGHYMHIEASV 568

  Fly   190 DAFG-TYHFLSPLYPKELSLSGA----CFQFHYFMFGSGVGSLLVSIKPVSVTIGDIFKTNHPYK 249
            ...| ....||.      :|.|.    |.||:|.|:|||:|.|.|.::........:..|:|   
Zfish   569 MLAGHKARLLSS------TLRGTRETQCLQFYYHMYGSGIGQLSVYLQTGQENDDRLLWTSH--- 624

  Fly   250 FDQFVMTGSQGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDV 298
                   |.||..||..:::.: .|:..|::|.||...|...|||:||:
Zfish   625 -------GEQGISWLRASLNYH-YDQQHQIVFEATRGASVRSDIAVDDI 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 55/175 (31%)
MAM 132..301 CDD:99706 55/175 (31%)
Somatomedin_B 336..376 CDD:279385
mamdc2bXP_017213507.1 MAM 41..175 CDD:279023
MAM 41..175 CDD:99706
MAM 178..334 CDD:279023
MAM 178..334 CDD:99706
MAM 349..502 CDD:279023 13/54 (24%)
MAM 349..502 CDD:99706 13/54 (24%)
MAM 516..674 CDD:279023 55/175 (31%)
MAM 516..672 CDD:99706 55/175 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9895
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7243
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.