DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and si:dkey-11o18.5

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_021324712.1 Gene:si:dkey-11o18.5 / 797166 ZFINID:ZDB-GENE-091204-110 Length:1192 Species:Danio rerio


Alignment Length:309 Identity:70/309 - (22%)
Similarity:117/309 - (37%) Gaps:103/309 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CDFESEDMCGWT---AELSFLGTW---KRVSTVADFHSEKTGPQKDHTFQNQSIGHYVRM-ETES 189
            ||||.|..||||   ||.:::  |   :|..|:.|     :||..|:| ...|.|.::.: ...|
Zfish    65 CDFEHEGKCGWTAKPAEGAYM--WQRQRRGKTLPD-----SGPSSDYT-TGTSTGWFMAVTAVTS 121

  Fly   190 DAFGTYHFLSPLYPKELSLSGAC-FQFHYFMFGS---GVGSLLVSIKPVSVTIGDIFKTNHPYKF 250
            ||..|....||.....   |..| .:..||::.|   |:|.        :...|.:.:|:.    
Zfish   122 DAPQTAILESPTIKHS---SPTCRLRLRYFIWDSGHTGMGE--------TPLWGSVRQTDG---- 171

  Fly   251 DQFVM---TGSQGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDVKLMAAKECARRSTF 312
            :|.|:   ..|....|.|..|.:.::...|.:...:..:..:.||:|||.::.:   :||     
Zfish   172 EQAVVWRPESSSFRGWREDVIYLGRITGPFNMQLHSRRSEGKQGDVAIDQMEFL---DCA----- 228

  Fly   313 IEEPKKPIEESDITDSLGYQMTDCSGRCGQDFVRGRYINEGC-----------RC-----QESCL 361
                 .|:...             ||:|...||:.:  .:||           .|     :|:|.
Zfish   229 -----LPVPPE-------------SGKCTAGFVQCK--RDGCVEEYKVCDGTDDCGDGTDEENCE 273

  Fly   362 VNGNCCLNYVKECHKDLVIAPYNELKFWRL-------WNLWSGDSNVTV 403
            .|.:|  |:            .:.|.:|.|       |. |:...|:::
Zfish   274 QNNSC--NF------------EDGLCWWDLRSMASLKWT-WTDQMNISL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 48/187 (26%)
MAM 132..301 CDD:99706 48/182 (26%)
Somatomedin_B 336..376 CDD:279385 13/55 (24%)
si:dkey-11o18.5XP_021324712.1 MAM 65..220 CDD:332481 46/177 (26%)
LDLa 238..272 CDD:238060 7/35 (20%)
MAM 278..435 CDD:99706 8/45 (18%)
MAM <514..629 CDD:332481
MAM 642..786 CDD:99706
MAM 792..947 CDD:99706
MAM 954..1104 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.