DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and Mamdc2

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_036017587.1 Gene:Mamdc2 / 71738 MGIID:1918988 Length:689 Species:Mus musculus


Alignment Length:233 Identity:67/233 - (28%)
Similarity:94/233 - (40%) Gaps:44/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PMKAKII----CSD--GHGLVGNRIAYCDGEKWSTQLGSC--ALRRQTIDVSCDFESEDMCGWTA 144
            ||..|::    |..  ..|||..       :..:.|||:|  ..|.......|.|: :|.|.:|.
Mouse   467 PMPTKVVFMSLCKSFWDCGLVAL-------DDITIQLGNCRSPARLPPPPGECTFD-QDECAFTQ 523

  Fly   145 ELSFLGTWKRVSTVADFHSEKTGPQKDHTFQNQSIGHYVRMETESDAFG-TYHFLSPLYPKELSL 208
            |.....:|.|..  .:..:..|||:.|||   ..:|:|:.:|.....:| ..|.||.      .|
Mouse   524 EKRNRSSWHRGR--GETPTSYTGPKGDHT---TGVGYYMYIEASHMVYGQKAHLLSQ------PL 577

  Fly   209 SGA----CFQFHYFMFGSGVGSLLVSIKPVSVTIGDIFKTNHPYKFDQFVMTGSQGARWLEHTID 269
            .|.    |..|.|.|:|:|.|.|.|.:|....:...:.          :...|.|...||...::
Mouse   578 RGVPGKHCLTFFYHMYGAGTGLLSVYLKREEDSEESLL----------WRRRGEQSISWLRALVE 632

  Fly   270 INKMDEDFQVIFTATDARSQYGDIAIDDVKLMAAKECA 307
            .: .....|:||.||...|...|||||||||.|. .||
Mouse   633 YS-CRRRHQIIFEATRGVSIRSDIAIDDVKLQAG-PCA 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 53/178 (30%)
MAM 132..301 CDD:99706 51/173 (29%)
Somatomedin_B 336..376 CDD:279385
Mamdc2XP_036017587.1 MAM 26..170 CDD:99706
MAM 173..330 CDD:395504
MAM 345..499 CDD:99706 10/38 (26%)
MAM 512..667 CDD:99706 53/178 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8224
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.