DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and nrp2b

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_998131.1 Gene:nrp2b / 405902 ZFINID:ZDB-GENE-040611-3 Length:920 Species:Danio rerio


Alignment Length:226 Identity:55/226 - (24%)
Similarity:96/226 - (42%) Gaps:47/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CDFESEDMCGWTAE-LSFLGTWKRVSTVADFHSEKTGPQKDHTFQNQSIGHYVRMETE--SDAFG 193
            |||| :.|||||.: :|.| .|...|:        :.|..|.|....:.|:::.:|..  |:. .
Zfish   630 CDFE-QSMCGWTHDPMSDL-KWSMYSS--------SSPSLDLTHGPDNFGNFLYVEASPMSEP-Q 683

  Fly   194 TYHFLSPLYPKELSLSGACFQFHYFMFGSGVGSLLVSIKPVSVTIGDIFKTNHPYKFDQ-----F 253
            ....|||....|..|  .|..|:|.:.|:|..||.|.::                ..||     :
Zfish   684 RARLLSPSVGPERRL--VCLLFYYQLRGAGQESLRVLLR----------------DDDQEETLLW 730

  Fly   254 VMTGSQGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDVKLMAA---KECARRSTFIEE 315
            .:.|.||:.|.|....:.:..:::||:......|...|.|.||::.:.::   ::|.:  .|...
Zfish   731 TLKGDQGSMWREGRTILPQSPKEYQVVIEGFFERGSRGHIRIDNIHMSSSIELEQCTQ--PFAAF 793

  Fly   316 PKKPIEE--SDITDSLGYQMTDCSGRCGQDF 344
            |.:..|.  .|:.::..::..|   |.||::
Zfish   794 PPEMTERRPEDLGNNRLFKGRD---RIGQEY 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 46/184 (25%)
MAM 132..301 CDD:99706 46/176 (26%)
Somatomedin_B 336..376 CDD:279385 3/9 (33%)
nrp2bNP_998131.1 CUB 26..139 CDD:238001
CUB 146..261 CDD:238001
FA58C 276..423 CDD:238014
FA58C 436..588 CDD:238014
MAM 630..779 CDD:366209 46/177 (26%)
DUF3481 842..920 CDD:371830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9895
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.