DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and mdga2a

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_021328869.1 Gene:mdga2a / 368826 ZFINID:ZDB-GENE-030616-360 Length:964 Species:Danio rerio


Alignment Length:190 Identity:54/190 - (28%)
Similarity:84/190 - (44%) Gaps:31/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CDFESEDMCGWTAELSFLGTWKR--VSTVADFHSEKTGPQKDHTFQNQSIGHYVRMET-----ES 189
            |.||.:.:|.:|.:.:....|.|  .:|....::..|||..|.:...|  |.|:.:||     |.
Zfish   755 CGFEEDTICMFTQDKTEEFDWTRHSAATRDTKYTPNTGPSSDRSGSKQ--GFYMYIETSRPRLEG 817

  Fly   190 DAFGTYHFLSPLY---PKE-----LSLSGACFQFHYFMFGSGVGSLLVSIKPVSVTIGDIFKTNH 246
            |   ....|:|.:   ||.     .|....||.|:|.|:|..:|:|.|.::..|.|..|.     
Zfish   818 D---KARLLTPSFNVAPKNPYGNVASNPTYCFSFYYHMYGKHIGTLNVYLRQKSQTGQDT----- 874

  Fly   247 PYKFDQFVMTGSQGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDVKLMAAKEC 306
                ..:.::|:||.||.:..::||. ...||::..........||||:|||.:... ||
Zfish   875 ----SVWTLSGNQGDRWRQARVNINP-TSSFQIVMEGIRGSGIEGDIAVDDVTIEEG-EC 928

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 52/188 (28%)
MAM 132..301 CDD:99706 52/183 (28%)
Somatomedin_B 336..376 CDD:279385
mdga2aXP_021328869.1 Ig_3 50..114 CDD:316449
IG 154..223 CDD:214652
IGc2 257..318 CDD:197706
I-set 350..421 CDD:333254
Ig_3 442..517 CDD:316449
MAM 755..929 CDD:306977 54/190 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9895
eggNOG 1 0.900 - - E1_2CMY0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.