DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and Mdga2

DIOPT Version :10

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001180195.2 Gene:Mdga2 / 320772 MGIID:2444706 Length:956 Species:Mus musculus


Alignment Length:191 Identity:53/191 - (27%)
Similarity:84/191 - (43%) Gaps:29/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CDFESEDMCGWTAELSFLGTWKRVSTVA--DFHSEKTGPQKDHTFQNQSIGHYV-----RMETES 189
            |.||..::|.:|.:.:....|.:.||..  ..::..|||..|.:...:....|:     |:|.|.
Mouse   748 CGFEDGNICLFTQDDTDNFDWTKQSTATRNTKYTPNTGPSADRSGSKEGFYMYIETSRPRLEGEK 812

  Fly   190 DAFGTYHFLSPLY------PKELSLSGACFQFHYFMFGSGVGSLLVSIKPVSVTIGDIFKTNHPY 248
                 ...|||::      |...:.|..||.|.|.|:|..:|.|.|.::         .|.....
Mouse   813 -----ARLLSPVFSIAPKNPYGPTNSAYCFSFFYHMYGQHIGVLNVYLR---------LKGQTTI 863

  Fly   249 KFDQFVMTGSQGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDVKLMAAKECARR 309
            :...:..:|::|.||.|..::|..: ..||:||.........||||||||.: |..|||::
Mouse   864 ENPLWSSSGNKGQRWNEAHVNIYPI-TSFQLIFEGIRGPGIEGDIAIDDVSI-AEGECAKQ 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 PHA02927 <19..>115 CDD:222943
MAM 132..301 CDD:459878 49/181 (27%)
Somatomedin_B 336..377 CDD:460034
Mdga2NP_001180195.2 IG_like 48..128 CDD:214653
Ig strand B 58..62 CDD:409394
Ig strand C 71..75 CDD:409394
Ig strand E 93..97 CDD:409394
Ig strand F 107..112 CDD:409394
Ig_3 134..219 CDD:464046
IG_like 251..328 CDD:214653
Ig strand B 260..264 CDD:409412
Ig strand C 274..278 CDD:409412
Ig strand E 293..297 CDD:409412
Ig strand F 307..312 CDD:409412
Ig 349..424 CDD:472250
Ig strand B 355..359 CDD:409353
Ig strand C 370..374 CDD:409353
Ig strand E 400..404 CDD:409353
Ig strand F 414..419 CDD:409353
Ig strand G 428..431 CDD:409353
Ig_3 441..518 CDD:464046
MAM 748..919 CDD:99706 50/186 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.