DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and Mdga1

DIOPT Version :10

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001401873.1 Gene:Mdga1 / 309659 RGDID:1307031 Length:956 Species:Rattus norvegicus


Alignment Length:227 Identity:65/227 - (28%)
Similarity:101/227 - (44%) Gaps:31/227 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GHGLVGNRIAYCDGEKWSTQLGSCALRRQTIDVSCDFESEDMCGWTAELSFLGTWKRVSTVAD-- 160
            |.|.:.:|:.:     ::..:.|.:|.    |.:|.||.|.:||:|.:|:....|.|.:.:..  
  Rat   729 GAGDMASRVIH-----YTEPINSPSLS----DNTCHFEDEKICGYTQDLTDNFDWTRQNALTQNP 784

  Fly   161 FHSEKTGPQKDHTFQNQSIGHYVRMETE--SDAFGTYHFLSPLYPKELSLSGACFQFHYFMFGSG 223
            ..|..|||..|  ......|:|:.:||.  .:.......:||||  ..|....|..|.|.|:|..
  Rat   785 KRSPNTGPPTD--ISGTPEGYYMFIETSRPRELGDRARLVSPLY--NASAKFYCVSFFYHMYGKH 845

  Fly   224 VGSLLVSIKPVSVTIGDIFKTNHPYKFDQFVMTGSQGARWLEHTIDINKMDEDFQVIFTATDARS 288
            :|||.:.::  |...|.:  ..|.:.     ::|::|..|.:..:.||. ...||:||.......
  Rat   846 IGSLNLLVR--SRNKGTL--DTHAWS-----LSGNKGNVWQQAHVPINP-SGPFQIIFEGVRGSG 900

  Fly   289 QYGDIAIDDVKLMAAKECARRSTFIEEPKKPI 320
            ..||||||||.|... ||.||..   :|.|.:
  Rat   901 YLGDIAIDDVTLKKG-ECPRRQM---DPNKVV 928

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 PHA02927 <19..>115 CDD:222943 3/16 (19%)
MAM 132..301 CDD:459878 52/172 (30%)
Somatomedin_B 336..377 CDD:460034
Mdga1NP_001401873.1 Ig 54..115 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 91..95 CDD:409353
Ig strand F 105..110 CDD:409353
Ig_3 132..217 CDD:464046
IG_like 248..326 CDD:214653
Ig strand B 258..262 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 291..295 CDD:409353
Ig strand F 305..310 CDD:409353
Ig strand G 319..322 CDD:409353
Ig 347..418 CDD:472250
Ig strand B 353..357 CDD:409353
Ig strand C 368..372 CDD:409353
Ig strand E 398..402 CDD:409353
Ig strand F 412..417 CDD:409353
Ig_3 439..515 CDD:464046
Ig_3 538..620 CDD:464046
MAM 754..917 CDD:99706 53/177 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..799 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.