DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and Nrp2

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001070871.1 Gene:Nrp2 / 18187 MGIID:1100492 Length:931 Species:Mus musculus


Alignment Length:216 Identity:48/216 - (22%)
Similarity:90/216 - (41%) Gaps:50/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 SCDFE-SEDMCGWTAELSFLGTWKRVSTVADFHSEKTGPQKDHTFQNQSIGHYVRMETESDAFGT 194
            :|:|: .|:.|||..:.:   .|.|.:.::      :....|.||.:..  ::::::::....|.
Mouse   645 NCNFDFPEETCGWVYDHA---KWLRSTWIS------SANPNDRTFPDDK--NFLKLQSDGRREGQ 698

  Fly   195 Y-HFLSPLYPKELSLSGACFQFHYFMFGSGVGSLLVSIKPVSVTIGDIFKTNHPYKFDQFVMTGS 258
            | ..:||  |..|..|..|.:|.|...| |.|..|..::..|.....:           :|:...
Mouse   699 YGRLISP--PVHLPRSPVCMEFQYQAMG-GHGVALQVVREASQESKLL-----------WVIRED 749

  Fly   259 QGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDVKLMAAKECARRSTFIEEPKKPIEES 323
            ||:.|....|.:...|.::|::|.....:.:.|:|:|||:::         ||.:     |:|..
Mouse   750 QGSEWKHGRIILPSYDMEYQIVFEGVIGKGRSGEISIDDIRI---------STDV-----PLENC 800

  Fly   324 DITDSLGYQMTDCSGRCGQDF 344
                     |...|...|:||
Mouse   801 ---------MEPISAFAGEDF 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 39/175 (22%)
MAM 132..301 CDD:99706 39/170 (23%)
Somatomedin_B 336..376 CDD:279385 4/9 (44%)
Nrp2NP_001070871.1 CUB 28..141 CDD:238001
CUB 149..265 CDD:238001
FA58C 277..427 CDD:214572
FA58C 280..426 CDD:238014
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..317
FA58C 433..592 CDD:214572
FA58C 438..591 CDD:238014
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..621
MAM 641..794 CDD:214533 40/182 (22%)
MAM 646..793 CDD:99706 39/180 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..854
DUF3481 849..928 CDD:152415
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.