DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and MAMDC4

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_996803.2 Gene:MAMDC4 / 158056 HGNCID:24083 Length:1137 Species:Homo sapiens


Alignment Length:226 Identity:62/226 - (27%)
Similarity:93/226 - (41%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LRRQTIDVSCDFESEDMCGW-TAELSFLGTWKRVSTVADFHSEKTGPQKDHTFQNQSIGHYVRME 186
            |:.|..:|||:|| .|.|.| ...||.. .|:.|        |..||..|||   ...||:|.::
Human   568 LQSQPREVSCNFE-RDTCSWYPGHLSDT-HWRWV--------ESRGPDHDHT---TGQGHFVLLD 619

  Fly   187 -TESDAFG-TYHFLS----PLYPKELSLSGACFQFHYFMFGSGVGSLLVSIKPVSVTIGDIFKTN 245
             |:..|:| :.|.||    |..|.|      |..|.|.:.|..:|:|.::::...       :..
Human   620 PTDPLAWGHSAHLLSRPQVPAAPTE------CLSFWYHLHGPQIGTLRLAMRREG-------EET 671

  Fly   246 HPYKFDQFVMTGSQGARWLEHTIDINKM---DEDFQVIFTATDARSQY-GDIAIDDVKL-----M 301
            |.:.     .:|:||.||.|....::..   ...:|::|..  .|..| |.:|:|||.:     .
Human   672 HLWS-----RSGTQGNRWHEAWATLSHQPGSHAQYQLLFEG--LRDGYHGTMALDDVAVRPGPCW 729

  Fly   302 AAKECARRSTFIEEPKKPIEESDITDSLGYQ 332
            |...|:            .|:||...|.|.|
Human   730 APNYCS------------FEDSDCGFSPGGQ 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 51/189 (27%)
MAM 132..301 CDD:99706 50/184 (27%)
Somatomedin_B 336..376 CDD:279385
MAMDC4NP_996803.2 MAM 63..219 CDD:214533
MAM 66..219 CDD:99706
LDLa 229..261 CDD:238060
MAM 271..425 CDD:279023
MAM 272..422 CDD:99706
LDLa 457..490 CDD:238060
MAM 577..729 CDD:279023 50/184 (27%)
MAM 577..728 CDD:99706 50/183 (27%)
MAM 734..890 CDD:279023 7/27 (26%)
MAM 734..888 CDD:99706 7/27 (26%)
MAM 889..1055 CDD:214533
MAM 894..1055 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9778
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.