DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and Cd55

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_006529178.1 Gene:Cd55 / 13136 MGIID:104850 Length:471 Species:Mus musculus


Alignment Length:151 Identity:38/151 - (25%)
Similarity:62/151 - (41%) Gaps:23/151 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLWAIV--LISSVDRTNARCLESVHLEHGSTEIVNGSIIFHCDQGYFLQG-SKVFTCDRGIP--- 61
            |:|:.|  ........|.:.|::.|:...:..:....|.|.|:.||.|.| |..|....|..   
Mouse   149 LVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDW 213

  Fly    62 RGKKPFCAKSGCQEYEQIQNGFV---LNAPMKAKII---CSDGHGLVGNRIAYC-----DGEKWS 115
            ..:.|.|.:..|.|..:|.||.:   .::...::::   |..|..||||...||     |..:||
Mouse   214 DDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWS 278

  Fly   116 TQLGSC------ALRRQTIDV 130
            :....|      ..::.||:|
Mouse   279 SPPPRCIEKSKVPTKKPTINV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023
MAM 132..301 CDD:99706
Somatomedin_B 336..376 CDD:279385
Cd55XP_006529178.1 CCP 36..95 CDD:153056
PHA02927 98..>292 CDD:222943 35/142 (25%)
Glycoprotein_G <285..361 CDD:144411 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5225
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.