DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and plxdc2

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_002933184.1 Gene:plxdc2 / 100494642 XenbaseID:XB-GENE-856530 Length:512 Species:Xenopus tropicalis


Alignment Length:331 Identity:62/331 - (18%)
Similarity:95/331 - (28%) Gaps:158/331 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KAKIICSDGHGLVGNRIAYCDGEKWSTQLGSCALRRQTIDVSCDFESEDMCGWTAELSFLGTWKR 154
            |.||     ||::.|                  ..||...|:..|          :..|.|.:.|
 Frog   126 KVKI-----HGILSN------------------THRQAARVNLSF----------DFPFYGHFLR 157

  Fly   155 VSTVADFHSEKTGPQKDHTFQNQSIGHYVRMETESDAFGTYHFLSPL---YPKELSLSGACFQFH 216
            ..|||......||          .:.|  ||.|.:      .:::||   :...:|.:..   ..
 Frog   158 EITVATGGFIYTG----------EVVH--RMLTAT------QYIAPLMANFDPSVSRNST---VR 201

  Fly   217 YFMFGSGV---------------------------GSLLVSIKPVSVTIGDIFKTNHPYKF---D 251
            ||..|:.:                           |.::...|.:.|.:..|..||||.|.   |
 Frog   202 YFDNGTALVVQWDHVHLRDNYSLGSFTFQATLINDGRIVFGYKDIPVPVMQISSTNHPVKVGLSD 266

  Fly   252 QFVMTGSQGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDVKLMAAKECARRSTFIEEP 316
            .||:              ::|:.:                   |.:|         ||.|..|..
 Frog   267 AFVV--------------VHKIQQ-------------------IPNV---------RRRTIFEYH 289

  Fly   317 KKPIEESDITDSLGYQM---------TDCSG-----------------RCGQDFVRGR--YINEG 353
            :..:|.:.||:....:|         ..||.                 ||...|.|.|  ::..|
 Frog   290 RVELEMTKITNFSAVEMLPLPTCLQFNSCSSCVSSMIGFNCSWCNILQRCSSGFDRHRQDWVENG 354

  Fly   354 CRCQES 359
            | .:||
 Frog   355 C-AEES 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 34/206 (17%)
MAM 132..301 CDD:99706 34/201 (17%)
Somatomedin_B 336..376 CDD:279385 11/43 (26%)
plxdc2XP_002933184.1 PSI 312..355 CDD:214655 7/42 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.