DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and tmprss15

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_031752048.1 Gene:tmprss15 / 100490249 XenbaseID:XB-GENE-999987 Length:994 Species:Xenopus tropicalis


Alignment Length:212 Identity:55/212 - (25%)
Similarity:85/212 - (40%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 VSCDFESEDMCGWTAELSFLGTWKRVSTVADFHSEKTGPQKDHTFQNQSIGHYVR--METESDAF 192
            ::|:|| :..|.|..|:.....|:||.  ...:...:||.:||||.|.| |:|:.  ::......
 Frog   319 INCNFE-DGFCYWFQEIQDYDGWERVH--GPTYPPTSGPNEDHTFGNSS-GYYLTPGIQVIPGIL 379

  Fly   193 GTYHFLS-PLYPKELSLSGACFQFHYFMFGSGVGSLLVSIKPVSVTIGDIFKTNHPYKFDQFVMT 256
            .:...|| ||....:.|   |..|.|.|:|..|..|         .:.:||..:.....  |...
 Frog   380 KSVRLLSLPLKENSVPL---CLSFWYHMYGVNVYRL---------NVFNIFANSTETII--FQKE 430

  Fly   257 GSQGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDVKLMAAKECARRSTFIEEPKKPIE 321
            |:.|..|....:.:::..... |.|.|.. ..::|||||||:.|....  ...|.|.|..:.|  
 Frog   431 GNYGPSWNYGQVTLSETSGTV-VAFEAIQ-NQRFGDIAIDDIGLFPGS--CNESGFPEPTRVP-- 489

  Fly   322 ESDITDSLGYQMTDCSG 338
               ...:.....:||.|
 Frog   490 ---TVPTTALLPSDCGG 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 48/176 (27%)
MAM 132..301 CDD:99706 47/171 (27%)
Somatomedin_B 336..376 CDD:279385 2/3 (67%)
tmprss15XP_031752048.1 SEA 36..>103 CDD:396113
LDLa 157..190 CDD:197566
CUB 199..305 CDD:238001
MAM 321..478 CDD:395504 48/178 (27%)
CUB 501..608 CDD:395345 2/3 (67%)
LDLa 620..654 CDD:238060
SR 655..746 CDD:214555
Tryp_SPc 760..991 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9933
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.