DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and si:dkey-163f14.6

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_009304399.1 Gene:si:dkey-163f14.6 / 100332398 ZFINID:ZDB-GENE-141215-18 Length:740 Species:Danio rerio


Alignment Length:122 Identity:33/122 - (27%)
Similarity:49/122 - (40%) Gaps:8/122 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWAIVLISSVDRTNARCLESVHLEHGSTEIVNGS--IIFHCDQGYFLQGSKVFTCDRGIPRGKKP 66
            ||.:. ..|.|:   .|....|||:|......|.  :.|.|:.|:.:.|.:..:|..|......|
Zfish    16 LWTLT-PGSADK---GCSGFGHLENGRMFFRYGGLYVTFTCNPGFRIHGYRTSSCVSGQWARDPP 76

  Fly    67 FCAKSGCQEYEQIQNG--FVLNAPMKAKIICSDGHGLVGNRIAYCDGEKWSTQLGSC 121
            .|..|||.....:.:|  .|......|...|..|..|.|:.:.||.|:.|::....|
Zfish    77 LCVASGCPGPGDLLHGSAVVSRDRSLASFSCDAGFYLSGSALLYCKGKNWNSTKPVC 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023
MAM 132..301 CDD:99706
Somatomedin_B 336..376 CDD:279385
si:dkey-163f14.6XP_009304399.1 CCP 28..79 CDD:153056 13/50 (26%)
CCP 83..133 CDD:214478 12/49 (24%)
CCP 461..521 CDD:214478
FXa_inhibition 527..563 CDD:291342
EGF_CA 565..604 CDD:284955
EGF_CA 606..647 CDD:214542
EGF_CA 648..689 CDD:214542
FXa_inhibition 694..730 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.