DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIV and mep1b

DIOPT Version :9

Sequence 1:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001096352.1 Gene:mep1b / 100124942 XenbaseID:XB-GENE-1001365 Length:722 Species:Xenopus tropicalis


Alignment Length:212 Identity:51/212 - (24%)
Similarity:82/212 - (38%) Gaps:29/212 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LVGNRIAYCDG--EKWSTQLGSCALRRQTIDVSCDFESEDMCGWTAELSFLGTWKRVSTVADFHS 163
            ::|.|:.:.|.  ||.: :|.:|:.....:| ||.||..::||..........|..|...|    
 Frog   234 VIGQRMDFSDYDLEKLN-RLYNCSSSISFMD-SCTFEYNNICGMIQGTGDNSDWNHVLLSA---- 292

  Fly   164 EKTGPQKDHTFQN--QSIGHYVRMETESDAFGTYHFLSP--LYPKELSLSGACFQFHYFMFGSGV 224
              .||..|||...  :..|:|:...|.:...|....|..  .|||.   ...|.:|.|:..|:..
 Frog   293 --AGPSNDHTHLGNCKDSGYYMHFSTSTGNAGDKALLESRLFYPKR---GFQCLEFFYYYNGNEN 352

  Fly   225 GSLLVSIKPVSVTIGDIFKTNHPYKFDQFV--MTGSQGARWLEHTIDINKMDEDFQVIFTATDAR 287
            .:|.:.|:.        :....|.....|:  :.|:....|..|.:.:| :...|:|:|......
 Frog   353 DALNIWIRE--------YTEASPNGTLTFITSIKGNPAEYWQLHHVSLN-VKNKFRVVFEGVKGN 408

  Fly   288 S-QYGDIAIDDVKLMAA 303
            . ..|..||||:....|
 Frog   409 GPSNGGFAIDDINFSEA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 42/179 (23%)
MAM 132..301 CDD:99706 41/175 (23%)
Somatomedin_B 336..376 CDD:279385
mep1bNP_001096352.1 ZnMc 26..255 CDD:412141 6/21 (29%)
MAM 265..428 CDD:395504 42/179 (23%)
MATH 427..590 CDD:351761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.