DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and KLK4

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:253 Identity:76/253 - (30%)
Similarity:125/253 - (49%) Gaps:27/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NPW-----KLSPRLDGRIVGG---HRINITD-APH----QVSLQTSSHI-CGGSIISEEWILTAA 89
            |||     .|...:.|.:|.|   ..||..| :||    |.:|...:.: |.|.::..:|:|:||
Human     6 NPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAA 70

  Fly    90 HCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAV 154
            ||........|.:....::.....|::.....|:|.::|...:..|..|::|...:...:|.:::
Human    71 HCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSI 135

  Fly   155 KLPESQMKYMDGEACFVSGWGNTQNLLESREW---LRQVEVPLVNQELCSEKYKQYGGVTERMIC 216
            .: .||.. ..|.:|.|||||    ||.:...   |:.|.|.:|::|:||:.|...  ....|.|
Human   136 SI-ASQCP-TAGNSCLVSGWG----LLANGRMPTVLQCVNVSVVSEEVCSKLYDPL--YHPSMFC 192

  Fly   217 AGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYG-CAKPDYPGVYSRVSFARDWIKE 273
            ||..:..||:|.||||||::. :|.|.|:||:|.. |.:...||||:.:....:||::
Human   193 AGGGQDQKDSCNGDSGGPLIC-NGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 69/233 (30%)
Tryp_SPc 51..274 CDD:238113 71/236 (30%)
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 69/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.