DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:274 Identity:103/274 - (37%)
Similarity:146/274 - (53%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KLSPRLDG--------------------------------RIVGGHRINITDAPHQVSLQTS-SH 73
            :|||||.|                                |||||..:.....|.|.|:... .|
Human   177 QLSPRLGGFLEEAWQPRNNCTSGQVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRH 241

  Fly    74 ICGGSIISEEWILTAAHCTYGKTADRL---KVRLG--TSEFARSGQLLRVQKIVQHAQFNYTNVD 133
            .||||:::..|::|||||.:.....||   :|..|  :....|..|...|::|:.|..::..|.|
Human   242 TCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHD 306

  Fly   134 YDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQ-NLLESREWLRQVEVPLVNQ 197
            ||.:||:|...:.|.:|..||.||..:..:..|..|:|||||:|. :...|.:.|:...|||.:.
Human   307 YDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFST 371

  Fly   198 ELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGE---LVGVVSWGYGCAKPDYPG 259
            :||:......|.:|.||:|||:|:|..||||||||||:|...|:   ||||||||.|||:|::||
Human   372 QLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLVGVVSWGRGCAEPNHPG 436

  Fly   260 VYSRVSFARDWIKE 273
            ||::|:...|||.:
Human   437 VYAKVAEFLDWIHD 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 95/230 (41%)
Tryp_SPc 51..274 CDD:238113 96/233 (41%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 6/35 (17%)
Tryp_SPc 217..448 CDD:214473 95/230 (41%)
Tryp_SPc 218..451 CDD:238113 96/233 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3602
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5191
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.