DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss8

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:256 Identity:85/256 - (33%)
Similarity:138/256 - (53%) Gaps:27/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RLDG-----------RIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWILTAAHC-TYGKTA 97
            |.||           ||.||........|.|||: ...:|:||||::|.:|:::|||| ....:.
Mouse    29 RADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFPREHSR 93

  Fly    98 DRLKVRLGTSE---FARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPES 159
            :..:|:||..:   ::....:..|.:|:.|:.:.......|.:|::|:.|:.|....:.:.||.:
Mouse    94 EAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAA 158

  Fly   160 QMKYMDGEACFVSGWGNT--QNLLESREWLRQVEVPLVNQELCSEKY------KQYGGVTERMIC 216
            ...:.:|..|.|:|||:.  ...|::...|:|:||||:::|.||..|      ::...:.:.|:|
Mouse   159 NASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLC 223

  Fly   217 AGFLEGGKDACQGDSGGPM---VSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
            ||:::|||||||||||||:   :.....|.|:||||..|..|:.||||:..|....||..|
Mouse   224 AGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 79/236 (33%)
Tryp_SPc 51..274 CDD:238113 80/238 (34%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 80/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.