DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss59

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001348859.1 Gene:Prss59 / 73481 MGIID:1920731 Length:251 Species:Mus musculus


Alignment Length:222 Identity:56/222 - (25%)
Similarity:96/222 - (43%) Gaps:25/222 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGT------SEFARSGQLLRVQ 119
            :.|:.|.||:|...|.|::|..:|:||||||:.     ..|:|||.      :|   ..|:....
Mouse    37 NVPYMVYLQSSPEPCVGTLIDPQWVLTAAHCSL-----PTKIRLGVYRPNIKNE---KEQICNYS 93

  Fly   120 KIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVS--GWGNTQNLLE 182
            ..|.|..|:...:..|..|::|::|...:.....:.:....|.:  .|:||:.  .|.|.:||.:
Mouse    94 FTVVHPNFDAKLLKNDLMLIKLSYPATINMYVGTIAIAMEPMAF--NESCFIPTWTWNNYKNLSD 156

  Fly   183 S--REWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGV 245
            .  ..|:.  |..|...:.....::|.......::|.|.......|.:..|..|.:. ||.:.|:
Mouse   157 PDILTWIN--EYSLSPSDCLDTLHQQKQETRINIMCIGHSLNAMSATKEVSAAPAIC-SGRVHGI 218

  Fly   246 VSWGYGCAKPDYPGVYSRV-SFARDWI 271
            :|||.........|.::.: .:|| ||
Mouse   219 LSWGKASVANGSKGFFTEIHPYAR-WI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 54/220 (25%)
Tryp_SPc 51..274 CDD:238113 56/222 (25%)
Prss59NP_001348859.1 Tryp_SPc 37..244 CDD:389826 54/220 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.