DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss44

DIOPT Version :10

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:238 Identity:96/238 - (40%)
Similarity:134/238 - (56%) Gaps:15/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQT-SSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSE-FARS 112
            |||||........|.|||||. ..||||||:||:.|::|||||.||..  ...|.:|.:: :::.
Mouse   111 RIVGGRPAPARKWPWQVSLQVHKQHICGGSLISKWWVITAAHCVYGHL--DYAVFMGDADLWSKR 173

  Fly   113 GQLLRVQKIVQHAQFN-YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGN 176
            ...:.||.|:.|..|: ...|.:|.:|:.||.|:.:....:.|.:||.......|..|:|:|||.
Mouse   174 PVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQPGTLCWVTGWGK 238

  Fly   177 TQNLLESREWLRQVEVPLVNQELCSEKYKQYGG-----VTERMICAGFLEGGKDACQGDSGGPMV 236
            ......|...|:::|:.::..|.|::..|...|     |.|..:| |:.|.|.||||||||||:|
Mouse   239 VLEQGRSSRILQEIELNIIRHEKCNQILKDIMGNIFTLVQEGGVC-GYNEKGGDACQGDSGGPLV 302

  Fly   237 SESGEL---VGVVSWGYGCAKPDYPGVYSRVSFARDW-IKEHS 275
            .|..:.   ||:||||.||.:..|||||:.||:.||| |||.|
Mouse   303 CEFNKTWVQVGIVSWGLGCGRIGYPGVYTEVSYYRDWIIKELS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 51..274 CDD:238113 93/234 (40%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 112..340 CDD:238113 90/230 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.