DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss41

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:243 Identity:88/243 - (36%)
Similarity:134/243 - (55%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQ-TSSHICGGSIISEEWILTAAHCTYGKTADRLK--VRLG--TSE- 108
            |||||........|.|.||: ..||.||||::|..|:|||||| :.|..|..|  |:||  ||: 
Mouse    83 RIVGGIESMQGRWPWQASLRLKKSHRCGGSLLSRRWVLTAAHC-FRKYLDPEKWTVQLGQLTSKP 146

  Fly   109 -----FARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEA 168
                 .|.||: .||:.|:.:::....:  :|.:||:||..:.:::..:.|.:..|.........
Mouse   147 SYWNRKAYSGR-YRVKDIIVNSEDKLKS--HDLALLRLASSVTYNKDIQPVCVQPSTFTSQHQPR 208

  Fly   169 CFVSGWGNTQNLLESRE---WLRQVEVPLVNQELCSEKYKQYG---GVTERMICAGFLEGGKDAC 227
            |:|:|||..|..|:...   .||:|:|.::|...|.|.::.:.   .:|:.:.|||..:|..|.|
Mouse   209 CWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLHHLITKDVFCAGAEDGSADTC 273

  Fly   228 QGDSGGPMVSESGEL---VGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            .||||||:|.....|   :|:||||.||.:|:.||:|:.||...:||:
Mouse   274 SGDSGGPLVCNMDGLWYQIGIVSWGIGCGRPNLPGIYTNVSHYYNWIE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 86/240 (36%)
Tryp_SPc 51..274 CDD:238113 87/242 (36%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.