DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss22

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:278 Identity:91/278 - (32%)
Similarity:154/278 - (55%) Gaps:21/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVS-LQTSSHI 74
            |.|:|:|..:.....|:    |...:..:|....|:...|||||........|..|| |:..||.
Mouse    72 QFSILILLVLLTSTAPI----SAATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHH 132

  Fly    75 CGGSIISEEWILTAAHCTYGKTADR---LKVRLGTSEFARSG---QLLRVQKIVQHAQFNYTNVD 133
            |.||:::..|::||||| :....|:   ..|.||..:....|   |.:.:..::.|.::::....
Mouse   133 CAGSLLTNRWVVTAAHC-FKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGT 196

  Fly   134 Y-DFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQN--LLESREWLRQVEVPLV 195
            : |.:|::|.|.|:|.|....:.||:|.::......|:::|||:.|:  .|...:.|::::||::
Mouse   197 HADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPII 261

  Fly   196 NQELCSEKYKQYGG---VTERMICAGFLEGGKDACQGDSGGPMVSESGE---LVGVVSWGYGCAK 254
            :.|||...|.:..|   :||.|:|||:|||.:|||.||||||::.:..:   |.|::|||.|||:
Mouse   262 DSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAE 326

  Fly   255 PDYPGVYSRVSFARDWIK 272
            .:.||||:.:...|.|::
Mouse   327 RNRPGVYTSLLAHRSWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 82/236 (35%)
Tryp_SPc 51..274 CDD:238113 82/238 (34%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 82/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.