DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Klk10

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:225 Identity:74/225 - (32%)
Similarity:110/225 - (48%) Gaps:26/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PHQVSL-QTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFA--RSGQLLRVQKIVQH 124
            |.|||| ......|.|.::.:.|:||||||...|.   |:.|:|.....  :..||......|.|
Mouse    59 PWQVSLFHNLQFQCAGVLVDQNWVLTAAHCWRNKP---LRARVGDDHLLLFQKEQLRSTSSPVFH 120

  Fly   125 AQFN--------YTNVDYDFSLLQLAHPIKFDETKKAVKLPE--SQMKYMDGEACFVSGWG-NTQ 178
            .::.        :.:.::|..:|:|:.|:........|:||.  ||    .|:.|.||||| :..
Mouse   121 PKYQACSGPILPHRSDEHDLMMLKLSSPVMLTSNVHPVQLPFRCSQ----PGQECQVSGWGTSAS 181

  Fly   179 NLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELV 243
            ..::....|...:|.|::|:.|...|.  |.:|..||||. .:|.:|:||.|||||:|.:. .|.
Mouse   182 RRVKYNRSLSCSKVTLLSQKQCETFYP--GVITNSMICAE-ADGNQDSCQSDSGGPLVCDD-TLH 242

  Fly   244 GVVSWG-YGCAKPDYPGVYSRVSFARDWIK 272
            ||:||| |.|....:|.|||.:.....||:
Mouse   243 GVLSWGIYPCGAAQHPSVYSEICKYTPWIR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 72/222 (32%)
Tryp_SPc 51..274 CDD:238113 74/225 (33%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 72/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.