DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Klk12

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:224 Identity:85/224 - (37%)
Similarity:115/224 - (51%) Gaps:30/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PHQVSLQTSSHI-CGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFAR---SGQLLRVQKIVQ 123
            |.||.|....:: |||.::..:|:||||||     .|:..||||.....:   :.||......:.
Mouse    34 PWQVGLFHGKYLRCGGVLVDRKWVLTAAHC-----RDKYVVRLGEHSLTKLDWTEQLRHTTFSIT 93

  Fly   124 HAQFN--YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREW 186
            |..:.  |.|.::|..||:|..||......:.|.||.|.:  ..|..|.|||||.|     ::.|
Mouse    94 HPSYQGAYQNHEHDLRLLRLNRPIHLTRAVRPVALPSSCV--TTGAMCHVSGWGTT-----NKPW 151

  Fly   187 ------LRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGV 245
                  |:.:.:..|:.|.|...:.  |.|||.|:|||. |.||||||||||||:|. .|.|.|:
Mouse   152 DPFPDRLQCLNLSTVSNETCRAVFP--GRVTENMLCAGG-EAGKDACQGDSGGPLVC-GGVLQGL 212

  Fly   246 VSWGY--GCAKPDYPGVYSRVSFARDWIK 272
            ||||.  .|.:...||||::|....|||:
Mouse   213 VSWGSVGPCGQKGIPGVYTKVCKYTDWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 83/221 (38%)
Tryp_SPc 51..274 CDD:238113 85/224 (38%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 83/221 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.