DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss37

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_080593.1 Gene:Prss37 / 67690 MGIID:1914940 Length:237 Species:Mus musculus


Alignment Length:232 Identity:58/232 - (25%)
Similarity:93/232 - (40%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 APHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGT-SEFARSG--QLLRVQKIVQ 123
            ||:...|:::.:.|.|.:|...|:|..:||    ....|:|.||. ....|.|  |.:...:|::
Mouse    27 APYLAYLKSNFNPCVGVLIKASWVLAPSHC----YLPNLRVMLGNFKSRVRDGTEQTIYPIQIIR 87

  Fly   124 HAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSG--WGNTQNLLESREW 186
            :..:::|....|..|::||.|..|:.  |...||.:......|..|.:||  |....|  .....
Mouse    88 YWNYSHTAPQDDLMLIKLAKPATFNH--KVQVLPIATTNVRPGTVCTLSGLDWSQENN--GRHPD 148

  Fly   187 LRQ-VEVPLVNQELCSEKYKQYGGVTERMICAGFLE------GG--------KDACQGDSGGPMV 236
            ||| :|.|::..:.|.:  .|.|......:|..|::      |.        |:..||...|..:
Mouse   149 LRQNLEAPVMTDKDCQK--TQQGSSHRNSLCVRFVKVFSRIFGEVAVATVICKNKLQGIEVGHFM 211

  Fly   237 SESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
               |..||:           |..:||.|.:.....||
Mouse   212 ---GGDVGI-----------YTNIYSYVPWIEKTTKE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 56/228 (25%)
Tryp_SPc 51..274 CDD:238113 58/232 (25%)
Prss37NP_080593.1 Tryp_SPc 28..231 CDD:389826 55/226 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.