DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and prss1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:237 Identity:92/237 - (38%)
Similarity:135/237 - (56%) Gaps:29/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRL-------- 104
            |.:||||:.......|:||||.:..|.||||:||..|:::||||    ...|::|||        
Zfish    22 DDKIVGGYECTKNGVPYQVSLNSGYHFCGGSLISNLWVVSAAHC----YKSRVQVRLGEHNIDVT 82

  Fly   105 -GTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEA 168
             ||.:|..|      :|:::|..:|...:|.|..|::|:...:.:...|.|.||.|...  .|.:
Zfish    83 EGTEQFINS------EKVIRHPSYNSNTLDNDVMLIKLSSSAQINSYVKTVSLPSSCAS--SGTS 139

  Fly   169 CFVSGWGN---TQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGD 230
            |.:|||||   :.:...||  |..:..|:::...|...|.  |.::..|.||||:|||||:||||
Zfish   140 CLISGWGNMSASGSNYPSR--LMCLNAPILSDSTCRNAYP--GQISSNMFCAGFMEGGKDSCQGD 200

  Fly   231 SGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            ||||:|. :.:|.|:||||||||:.:.||||::|.....||:
Zfish   201 SGGPVVC-NNQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 89/232 (38%)
Tryp_SPc 51..274 CDD:238113 91/234 (39%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 89/232 (38%)
Tryp_SPc 25..243 CDD:238113 91/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3303
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.