DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PRTN3

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:243 Identity:69/243 - (28%)
Similarity:102/243 - (41%) Gaps:47/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IVGGHRINITDAPHQVSLQ----TSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFAR 111
            |||||.......|:..|||    ..||.|||::|...::||||||........:.|.||...   
Human    28 IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHN--- 89

  Fly   112 SGQLLRVQKIVQH----AQFNYTNVD-----YDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGE 167
                :|.|:..|.    ||....|.|     .|..|:||:.|.....:...|:||:.......|.
Human    90 ----VRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT 150

  Fly   168 ACFVSGWGNTQNLLESREWLRQVEVPLVN-----QELCSEKYKQYGGVTERMICAGFLEGGKDAC 227
            .|...|||.........:.|:::.|.:|.     ..:|:...::..|:                |
Human   151 QCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGI----------------C 199

  Fly   228 QGDSGGPMVSESGELVGV---VSWGYGCAKPDYPGVYSRVSFARDWIK 272
            .||||||::.: |.:.|:   |.|  |||...:|..::||:...|||:
Human   200 FGDSGGPLICD-GIIQGIDSFVIW--GCATRLFPDFFTRVALYVDWIR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 67/240 (28%)
Tryp_SPc 51..274 CDD:238113 69/243 (28%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.