DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and KLK10

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:286 Identity:88/286 - (30%)
Similarity:130/286 - (45%) Gaps:50/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGR-IVGGHRINITDAPHQVSL 68
            :|..||...|.. |...|:||             |..:|.|...|. ...|.:      |.||||
Human    19 KLLPLLMAQLWA-AEAALLPQ-------------NDTRLDPEAYGSPCARGSQ------PWQVSL 63

  Fly    69 QTS-SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSE--FARSGQLLRVQKIVQHAQFNY- 129
            ... |..|.|.::.:.|:||||||  |...  |..|:|...  ..:..||.|..:.|.|.:::. 
Human    64 FNGLSFHCAGVLVDQSWVLTAAHC--GNKP--LWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQG 124

  Fly   130 -------TNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKY---MDGEACFVSGWGNT-QNLLES 183
                   ...::|..||:||.|:......:|::||     |   ..|:.|.|:|||.| ...::.
Human   125 SGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLP-----YRCAQPGDQCQVAGWGTTAARRVKY 184

  Fly   184 REWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSW 248
            .:.|....:.:::.:.|...|.  |.||..||||| |:.|:|.||.|||||:|.:. .|.|::||
Human   185 NKGLTCSSITILSPKECEVFYP--GVVTNNMICAG-LDRGQDPCQSDSGGPLVCDE-TLQGILSW 245

  Fly   249 G-YGCAKPDYPGVYSRVSFARDWIKE 273
            | |.|....:|.||:::.....||.:
Human   246 GVYPCGSAQHPAVYTQICKYMSWINK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 74/237 (31%)
Tryp_SPc 51..274 CDD:238113 76/239 (32%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 77/242 (32%)
Tryp_SPc 49..269 CDD:214473 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.