DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:210 Identity:69/210 - (32%)
Similarity:103/210 - (49%) Gaps:34/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIK 146
            ::.::.|...|.|...       ||.::::...|      :.|..:|.:..:.|..|::|:.||:
Zfish     2 DQMMVVAGDYTLGANE-------GTEQYSKPLML------IPHPLYNRSTNNADIMLIKLSAPIE 53

  Fly   147 FDETKKAVKLPESQMKYMDGEACFVSGWGNTQN---LLESREWLRQVEVPLVNQELCSEKYKQYG 208
            .:.......||:.....:.|..|.|||||:|.:   |:...  ||.|.:|:|:...|:......|
Zfish    54 LNRYVSLAPLPKQNTGLLAGRMCRVSGWGSTSHSGGLIPLT--LRTVRLPIVSTFKCNSSSSFSG 116

  Fly   209 GVTERMICAGFLEGGKDA---------------CQGDSGGPMVSESGELVGVVSWGYGCAKPDYP 258
            .:|..|||||...|||||               ||||||||:|.: |.:.|:||||.||..|.:|
Zfish   117 NITANMICAGSSTGGKDACKNSTQYLCHLIVYLCQGDSGGPLVCD-GRVYGLVSWGNGCGDPRFP 180

  Fly   259 GVYSRVSFARDWIKE 273
            |||:.||..|.||.:
Zfish   181 GVYTAVSRFRRWIDQ 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 67/206 (33%)
Tryp_SPc 51..274 CDD:238113 69/210 (33%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 69/210 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.