DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PRSS2

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:243 Identity:98/243 - (40%)
Similarity:141/243 - (58%) Gaps:25/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTY-----------GKTADRLK 101
            |.:||||:.......|:||||.:..|.||||:|||:|:::|.|| |           |....|::
Human    21 DDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHC-YKSAINSKLSGRGCEYHRIQ 84

  Fly   102 VRLGTSE---FARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKY 163
            ||||...   ...:.|.:...||::|.::|...:|.|..|::|:.|...:....|:.||.:..  
Human    85 VRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPP-- 147

  Fly   164 MDGEACFVSGWGNTQNLLESREW---LRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKD 225
            ..|....:||||||  |....::   |:.::.|:::|..|...|.  |.:|..|.|.||||||||
Human   148 AAGTESLISGWGNT--LSSGADYPDELQCLDAPVLSQAECEASYP--GKITNNMFCVGFLEGGKD 208

  Fly   226 ACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            :||||||||:|| :|||.|:||||||||:.:.||||::|....||||:
Human   209 SCQGDSGGPVVS-NGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 94/237 (40%)
Tryp_SPc 51..274 CDD:238113 97/240 (40%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 94/237 (40%)
Tryp_SPc 24..256 CDD:238113 97/240 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I3865
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.