DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PRSS1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:229 Identity:89/229 - (38%)
Similarity:134/229 - (58%) Gaps:13/229 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSE---F 109
            |.:||||:.......|:||||.:..|.||||:|:|:|:::|.||    ...|::||||...   .
Human   246 DDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHC----YKSRIQVRLGEHNIEVL 306

  Fly   110 ARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGW 174
            ..:.|.:...||::|.|::...::.|..|::|:.....:.....:.||.:..  ..|..|.:|||
Human   307 EGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPP--ATGTKCLISGW 369

  Fly   175 GNTQNL-LESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSE 238
            |||.:. .:..:.|:.::.|:::|..|...|.  |.:|..|.|.||||||||:||||||||:|. 
Human   370 GNTASSGADYPDELQCLDAPVLSQAKCEASYP--GKITSNMFCVGFLEGGKDSCQGDSGGPVVC- 431

  Fly   239 SGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            :|:|.||||||.|||:.:.||||::|.....|||
Human   432 NGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 85/224 (38%)
Tryp_SPc 51..274 CDD:238113 88/226 (39%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 85/224 (38%)
Tryp_SPc 249..467 CDD:238113 88/226 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I3865
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.