DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and KLK15

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:232 Identity:76/232 - (32%)
Similarity:117/232 - (50%) Gaps:29/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 APH----QVSLQTSSHI-CGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEF-ARSG--QLLRV 118
            |||    ||:|...... ||.|:||..|:|:||||    .:..::||||.... .|.|  ||...
Human    29 APHSQPWQVALYERGRFNCGASLISPHWVLSAAHC----QSRFMRVRLGEHNLRKRDGPEQLRTT 89

  Fly   119 QKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGW--------- 174
            .:::.|.::...:...|..||:|..|.:.:...:...|| ::..: .||||.||||         
Human    90 SRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLP-TRCPH-PGEACVVSGWGLVSHNEPG 152

  Fly   175 --GNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVS 237
              |:.::.:...:.|....:.:::...|.:.|.  |.:|..|:|||....|.::|:||||||:|.
Human   153 TAGSPRSQVSLPDTLHCANISIISDTSCDKSYP--GRLTNTMVCAGAEGRGAESCEGDSGGPLVC 215

  Fly   238 ESGELVGVVSWG-YGCAKPDYPGVYSRVSFARDWIKE 273
             .|.|.|:|||| ..|.....||||::|....:||:|
Human   216 -GGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 73/228 (32%)
Tryp_SPc 51..274 CDD:238113 76/232 (33%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.