DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Tpsab1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:307 Identity:108/307 - (35%)
Similarity:150/307 - (48%) Gaps:51/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLQCSLLVLAGVCLIPQPV--------KRQRS----------------LEDVIKNPWKLSPRLDG 49
            |..|||  :.|:...||||        .|.|:                |..::.....|:...:|
  Rat     3 LPSCSL--VPGLFCTPQPVGPSPALTSNRARTTHCVRMLKLLLLTLPLLSSLVHAAPSLAMPREG 65

  Fly    50 RIVGGHRINITDAPHQVSLQTSS----HICGGSIISEEWILTAAHCTYGKTAD--RLKVRLGTSE 108
             ||||...:....|.||||:.:.    |.||||:|..:|:||||||.....||  :|:|:|....
  Rat    66 -IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQY 129

  Fly   109 FARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSG 173
            ......||.|.:|:.|..|.......|.:||:|.:|:........|.||.:...:..|..|:|:|
  Rat   130 LYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCWVTG 194

  Fly   174 WGNTQN--LLESREWLRQVEVPLVNQELCSEKYKQYGG---------VTERMICAGFLEGGKDAC 227
            |||..|  .|.....|.:|:||:|...||..||  :.|         |.:.|:|||  ..|.|:|
  Rat   195 WGNINNDVSLPPPFPLEEVQVPIVENRLCDLKY--HKGLNTGDNVHIVRDDMLCAG--NEGHDSC 255

  Fly   228 QGDSGGPMVSESGEL---VGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            |||||||:|.:..:.   .||||||.|||:|:.||:|:||::..|||
  Rat   256 QGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 92/240 (38%)
Tryp_SPc 51..274 CDD:238113 94/241 (39%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 92/239 (38%)
Tryp_SPc 66..302 CDD:238113 92/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.