DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PLAT

DIOPT Version :10

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_000921.1 Gene:PLAT / 5327 HGNCID:9051 Length:562 Species:Homo sapiens


Alignment Length:255 Identity:88/255 - (34%)
Similarity:128/255 - (50%) Gaps:35/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQTSSH--------ICGGSIISEEWILTAAHCTYGK-TADRLKVRLG 105
            ||.||...:|...|.|.:: .:.|        :|||.:||..|||:||||...: ....|.|.||
Human   310 RIKGGLFADIASHPWQAAI-FAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILG 373

  Fly   106 TSEFARSG---QLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETK--------KAVKLPES 159
            .:.....|   |...|:|.:.|.:|:....|.|.:||||    |.|.::        :.|.||.:
Human   374 RTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQL----KSDSSRCAQESSVVRTVCLPPA 434

  Fly   160 QMKYMDGEACFVSGWGNTQNLLE-SREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGG 223
            .::..|...|.:||:|..:.|.. ..|.|::..|.|.....|:.::.....||:.|:|||....|
Human   435 DLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSG 499

  Fly   224 ------KDACQGDSGGPMVS-ESGE--LVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
                  .||||||||||:|. ..|.  |||::|||.||.:.|.||||::|:...|||:::
Human   500 GPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDN 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 51..274 CDD:238113 87/252 (35%)
PLATNP_000921.1 FN1 41..83 CDD:214494
Important for binding to annexin A2 42..52
EGF 86..117 CDD:394967
KR 125..209 CDD:238056
Kringle 215..296 CDD:395005
Tryp_SPc 313..559 CDD:238113 86/250 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.