DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Elane

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:234 Identity:68/234 - (29%)
Similarity:103/234 - (44%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PRLDGRIVGGHRINITDAPHQVSLQ-TSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSE 108
            |.|...||||........|...||| ...|.||.::|:..::::||||..|.....::|.||..:
Mouse    23 PALASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHD 87

  Fly   109 F---ARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACF 170
            .   .|:.|...||:|.::. |:.:.:..|..::||......:...:..:||.......|...|.
Mouse    88 LRRQERTRQTFSVQRIFENG-FDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCL 151

  Fly   171 VSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPM 235
            ..|||.......|...|:::.|.:|. .:|..:......|..|.  ||.       |.||||||:
Mouse   152 AMGWGRLGTNRPSPSVLQELNVTVVT-NMCRRRVNVCTLVPRRQ--AGI-------CFGDSGGPL 206

  Fly   236 VSESGELV-GVVSW--GYGCAKPDYPGVYSRVSFARDWI 271
            |..:  || |:.|:  | ||....||..::.|:...|||
Mouse   207 VCNN--LVQGIDSFIRG-GCGSGLYPDAFAPVAEFADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 64/227 (28%)
Tryp_SPc 51..274 CDD:238113 66/228 (29%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 64/227 (28%)
Tryp_SPc 29..245 CDD:238113 66/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.