DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss33

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:246 Identity:95/246 - (38%)
Similarity:133/246 - (54%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PRLDGRIVGGHRINITDAPHQVSLQ-TSSHICGGSIISEEWILTAAHCTYGKT-ADRLKVRLG-- 105
            ||:..|||||......:.|.|.|:| ..:|:||||:|:.:|:|||.||...:. .....|.||  
  Rat    28 PRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWVLTAGHCFSRRVLPSEYSVLLGAL 92

  Fly   106 TSEFARSGQLL-RVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEAC 169
            :.:...|.:|| .|.:::....::......|.:||||:||:......:.|.||........|..|
  Rat    93 SLDVTSSHELLVPVLRVLLPPDYSEDEARGDLALLQLSHPVSLSARIQPVCLPAPGSHPPPGSPC 157

  Fly   170 FVSGWGNTQ---NLLESREWLRQVEVPLVNQELCSEKYKQYGGV--TERMI-----CAGFLEGGK 224
            :|:|||:..   .|.:.|. |:.|.|||::...|...|.....|  :||::     |||:..|.|
  Rat   158 WVTGWGSLSPGVPLPKGRP-LQGVRVPLLDSRACDRLYHMGANVPKSERIVLPGNLCAGYRRGHK 221

  Fly   225 DACQGDSGGPMV-SESGE--LVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            ||||||||||:. .|||.  ||||||||.|||.|:.||||:.|:....||:
  Rat   222 DACQGDSGGPLTCMESGRWVLVGVVSWGKGCALPNRPGVYTNVAKYSPWIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 91/238 (38%)
Tryp_SPc 51..274 CDD:238113 92/240 (38%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 91/238 (38%)
Tryp_SPc 34..272 CDD:238113 91/238 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.