DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and try10

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:271 Identity:108/271 - (39%)
Similarity:153/271 - (56%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTSSH 73
            ||..|||.||    :.||:      ||            |.:||||:..::   |:||||....|
 Frog     4 LLLFSLLGLA----VAQPI------ED------------DDKIVGGYHCSV---PYQVSLNAGYH 43

  Fly    74 ICGGSIISEEWILTAAHCTYGKTADRL---KVRL--GTSEFARSGQLLRVQKIVQHAQFNYTNVD 133
            .||||:|:|.|:::||||...|...|:   .:.|  ||.:|.:|.      ||::|.|:|...:|
 Frog    44 FCGGSLINEHWVVSAAHCYQSKMELRIGENNIELLEGTEQFIQSA------KIIRHPQYNSWTID 102

  Fly   134 YDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNT-QNLLESREWLRQVEVPLVNQ 197
            .|..|:||..|.:.:...:.:.||......  |..|.:|||||| .|.:...:.|:.:|.|:::.
 Frog   103 NDIMLIQLQEPAQLNNEVQPIPLPTECPPV--GSICLISGWGNTLSNGVNYPDLLQCIEAPILSD 165

  Fly   198 ELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYS 262
            :.|.:.|.  |.:|:.|||.|:||||.|:||||||||:|.: |||.||||||.|||.|.|||||:
 Frog   166 QECRQSYP--GSITDNMICVGYLEGGIDSCQGDSGGPVVCD-GELQGVVSWGRGCALPGYPGVYT 227

  Fly   263 RVSFARDWIKE 273
            :|.....||::
 Frog   228 KVCNYLSWIRD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 94/226 (42%)
Tryp_SPc 51..274 CDD:238113 96/229 (42%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 96/229 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5191
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.