DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and LOC496623

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001011199.1 Gene:LOC496623 / 496623 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:232 Identity:94/232 - (40%)
Similarity:134/232 - (57%) Gaps:19/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARS 112
            |.:|:||........|:.|||.:..|.||||:|:.:|:::||||....    ::||||....|.|
 Frog    18 DDKIIGGATCAKNSVPYIVSLNSGYHFCGGSLINNQWVVSAAHCYKAS----IQVRLGEHNIALS 78

  Fly   113 ---GQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGW 174
               .|.:...|:::|:.:|...:|.|..|::|:.....:....||.||....  ..|.:|.:|||
 Frog    79 EGTEQFISSSKVIRHSGYNSWTLDNDIMLIKLSSAASLNAAVNAVALPSGCA--AAGASCLISGW 141

  Fly   175 GNTQNLLES----REWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPM 235
            |||   |.|    .:.|:.:..|::....|:..|.  |.:|..|||.||||||||:||||||||:
 Frog   142 GNT---LSSGSNYPDLLQCLYAPILTDAQCNNAYP--GEITNNMICLGFLEGGKDSCQGDSGGPV 201

  Fly   236 VSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            |. :|||.||||||||||:.:|||||::|.....||:
 Frog   202 VC-NGELQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQ 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 91/227 (40%)
Tryp_SPc 51..274 CDD:238113 93/229 (41%)
LOC496623NP_001011199.1 Tryp_SPc 21..239 CDD:238113 93/229 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3316
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm9407
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.