DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and prss27

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:254 Identity:93/254 - (36%)
Similarity:143/254 - (56%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PRLDGRIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWILTAAHC---TYGKTADRLKVRLG 105
            |....|||||:.....:.|.|||: ..:|||||||::|..|:::||||   :|  ..:.::|.||
 Frog   414 PAFSDRIVGGNNAVFGEWPWQVSIVYQNSHICGGSLVSSNWVVSAAHCFPRSY--KIENMQVLLG 476

  Fly   106 -------TSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKY 163
                   ||:    ..::||::::.:..:.......|.:::::..|:.:......:.:|.:...:
 Frog   477 CFALMNLTSD----AVIIRVKRVITYPLYTGEGSSGDIAMVEMESPVTYSSYILPICIPLTNEDF 537

  Fly   164 MDGEACFVSGWGNTQN--LLESREWLRQVEVPLVNQELCSEKYKQYGG--------VTERMICAG 218
            ..|:.|:|:||||.|:  .|.....|::|||||||...|...| .|..        |.:.|||||
 Frog   538 PSGKMCWVTGWGNIQSDVSLSPPYPLQEVEVPLVNASSCDTMY-HYNSDLNPATQLVHDDMICAG 601

  Fly   219 FLEGGKDACQGDSGGPMVSESGE---LVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
            :.||.|||||||||||:..:||.   |.|:||||.|||:|:.||||::||....||.::
 Frog   602 YPEGQKDACQGDSGGPLACKSGNYWFLTGIVSWGDGCAQPNRPGVYTKVSSFSSWINQY 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 90/244 (37%)
Tryp_SPc 51..274 CDD:238113 91/246 (37%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113
Tryp_SPc 420..659 CDD:238113 91/245 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.