DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and betaTry

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster


Alignment Length:271 Identity:112/271 - (41%)
Similarity:145/271 - (53%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSL 68
            |:..:||......|.|.  ||:                .|.|:||||||||....|:..|.|:||
  Fly     2 LKFLILLSAVACALGGT--IPE----------------GLLPQLDGRIVGGTATTISSFPWQISL 48

  Fly    69 QTS-SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNV 132
            |.| ||.|||||.|...|:|||||....:|..|::|.|:|.::..|.:.:|.....|..:|...:
  Fly    49 QRSGSHSCGGSIYSARVIVTAAHCLQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTM 113

  Fly   133 DYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLES-REWLRQVEVPLVN 196
            ..|.::|.|:..:.|..|.||:.|..|..  .:|.|..|||||...:...| ...||.|.|.:|:
  Fly   114 VNDIAVLHLSSSLSFSSTIKAIGLASSNP--ANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVS 176

  Fly   197 QELCSEKYKQYGG-VTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGV 260
            |..||.....||. :...||||  ...|||:||||||||:|| .|.||||||||||||..:||||
  Fly   177 QSRCSSSSYGYGNQIKSSMICA--FASGKDSCQGDSGGPLVS-GGVLVGVVSWGYGCAAANYPGV 238

  Fly   261 YSRVSFARDWI 271
            |:.|:..|.|:
  Fly   239 YADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 99/223 (44%)
Tryp_SPc 51..274 CDD:238113 99/224 (44%)
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 99/223 (44%)
Tryp_SPc 31..252 CDD:238113 99/224 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443361
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.