DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and prss3

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001004941.1 Gene:prss3 / 448342 XenbaseID:XB-GENE-6372192 Length:249 Species:Xenopus tropicalis


Alignment Length:239 Identity:94/239 - (39%)
Similarity:139/239 - (58%) Gaps:21/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PRLDGRIVGGHRINITDAPHQVSLQ-TSSHICGGSIISEEWILTAAHC----TYGKTADRLKVRL 104
            |..|.|||||:.......|.||.|. ..|..||||:|:..||::||||    .|      :...:
 Frog    17 PLDDSRIVGGYECAPHSKPWQVHLNYKGSFFCGGSLIAPRWIVSAAHCYLLPKY------VVAHI 75

  Fly   105 GTSEFARSG---QLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDG 166
            |..:.:::.   |:::|:|..||.::|.:|:|.|..|::||.|.:|:...:.:.|..|..  |.|
 Frog    76 GMHDVSKAEGTVQIIQVEKSFQHYKYNSSNIDNDIMLIKLAEPAQFNHHVQPIPLAHSCP--MKG 138

  Fly   167 EACFVSGWGNTQN--LLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQG 229
            ..|.|||:||.:.  ..|..:.|:.:::|::.::.|...|..  .:|..|.||||.|||||:|||
 Frog   139 TRCVVSGYGNMRPGFFGEFPDRLQCLDLPVLPEDSCKSSYGD--DITNNMFCAGFQEGGKDSCQG 201

  Fly   230 DSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            |||||:|.: |||.||||||:.|||..|||||::|....||:.:
 Frog   202 DSGGPLVCD-GELFGVVSWGHECAKKGYPGVYTKVCHYIDWVND 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 91/230 (40%)
Tryp_SPc 51..274 CDD:238113 91/233 (39%)
prss3NP_001004941.1 Tryp_SPc 23..245 CDD:238113 91/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.